PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598545.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 437aa    MW: 49526.4 Da    PI: 6.3864
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598545.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.72.1e-07100162163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     eke +r rr   NRe+Ar   +R++a +eeL++k++ L  eN+ Lkk+ e    e+++l++++
  XP_009598545.1 100 EKEGRRLRRVFANRESARQTIRRRQAMQEELTRKAADLALENENLKKNKELAAAEYSSLRNKN 162
                     78889********************************************999*******9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001701.6E-6100162IPR004827Basic-leucine zipper domain
SMARTSM003381.3E-5100164IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.438102165IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.5E-4104169No hitNo description
CDDcd147025.84E-11105156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MEYEEMHKTT PCAADGRFSD DELVEYEWEA AEALACLSHP VTGDVQLYMD ARDVAGLYST  60
EQEIAIRSED ESELDTSLLC ASNNPPVTSS KSRQDLTEAE KEGRRLRRVF ANRESARQTI  120
RRRQAMQEEL TRKAADLALE NENLKKNKEL AAAEYSSLRN KNSSLKTQMA KIVKAEVQET  180
YDESKLTPVE TPSTWTTFPT FLHNQTQATP FFWSTVFQPL QSGSQSIYGF TQELPKPLGE  240
FKRSDQLESH MMMNKPLYIL PFPFHAESNP FYPPSSNHNE QHETSVVHEC STSNPRTTVN  300
MENHLTATPL KVETETTDSI NTIHRDILRE ADSGYLLNEG SGQLLGLRSK EMLQVTANSS  360
PFVRPVITRQ SIRNSPQQDN TTPDVKVTSS AGGHVAGASP KMYQATRLQM PLYIAAKARR  420
KRKELMKLKS QCYYQFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1418423RRKRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598545.10.0PREDICTED: uncharacterized protein LOC104094330
TrEMBLM1CQ744e-76M1CQ74_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000723831e-75(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54171724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.12e-18bZIP family protein